- Recombinant Acinetobacter baumannii UPF0391 membrane protein ACICU_03627 (ACICU_03627)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1030919
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 5,462 Da
- E Coli or Yeast
- 18994
- UPF0391 membrane protein ACICU_03627 (ACICU_03627)
Sequence
MFRWAIIFAVIALIASLLGFGGVAGLSKDFAVILLVIAVILAVIGFISRGRT